OSBPL8 polyclonal antibody
  • OSBPL8 polyclonal antibody

OSBPL8 polyclonal antibody

Ref: AB-PAB28410
OSBPL8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OSBPL8.
Información adicional
Size 100 uL
Gene Name OSBPL8
Gene Alias DKFZp686A11164|MGC126578|MGC133203|MST120|MSTP120|ORP8|OSBP10
Gene Description oxysterol binding protein-like 8
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQTKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human OSBPL8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114882
Iso type IgG

Enviar uma mensagem


OSBPL8 polyclonal antibody

OSBPL8 polyclonal antibody