MYH7 polyclonal antibody
  • MYH7 polyclonal antibody

MYH7 polyclonal antibody

Ref: AB-PAB28402
MYH7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYH7.
Información adicional
Size 100 uL
Gene Name MYH7
Gene Alias CMD1S|CMH1|DKFZp451F047|MGC138376|MGC138378|MPD1|MYHCB|SPMD|SPMM
Gene Description myosin, heavy chain 7, cardiac muscle, beta
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MYH7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4625
Iso type IgG

Enviar uma mensagem


MYH7 polyclonal antibody

MYH7 polyclonal antibody