PLOD3 polyclonal antibody
  • PLOD3 polyclonal antibody

PLOD3 polyclonal antibody

Ref: AB-PAB28401
PLOD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLOD3.
Información adicional
Size 100 uL
Gene Name PLOD3
Gene Alias LH3
Gene Description procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEAL
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PLOD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8985
Iso type IgG

Enviar uma mensagem


PLOD3 polyclonal antibody

PLOD3 polyclonal antibody