DMC1 polyclonal antibody
  • DMC1 polyclonal antibody

DMC1 polyclonal antibody

Ref: AB-PAB28400
DMC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DMC1.
Información adicional
Size 100 uL
Gene Name DMC1
Gene Alias DMC1H|HsLim15|LIM15|MGC150472|MGC150473|dJ199H16.1
Gene Description DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DMC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11144
Iso type IgG

Enviar uma mensagem


DMC1 polyclonal antibody

DMC1 polyclonal antibody