CBS polyclonal antibody
  • CBS polyclonal antibody

CBS polyclonal antibody

Ref: AB-PAB28399
CBS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CBS.
Información adicional
Size 100 uL
Gene Name CBS
Gene Alias HIP4
Gene Description cystathionine-beta-synthase
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CBS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 875
Iso type IgG

Enviar uma mensagem


CBS polyclonal antibody

CBS polyclonal antibody