GAL3ST1 polyclonal antibody
  • GAL3ST1 polyclonal antibody

GAL3ST1 polyclonal antibody

Ref: AB-PAB28396
GAL3ST1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GAL3ST1.
Información adicional
Size 100 uL
Gene Name GAL3ST1
Gene Alias CST
Gene Description galactose-3-O-sulfotransferase 1
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFNAHYLRNLLFFDLGYDNSLDPSSPQVQEHIL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human GAL3ST1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9514
Iso type IgG

Enviar uma mensagem


GAL3ST1 polyclonal antibody

GAL3ST1 polyclonal antibody