RNF139 polyclonal antibody
  • RNF139 polyclonal antibody

RNF139 polyclonal antibody

Ref: AB-PAB28393
RNF139 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNF139.
Información adicional
Size 100 uL
Gene Name RNF139
Gene Alias HRCA1|MGC31961|RCA1|TRC8
Gene Description ring finger protein 139
Storage Conditions Store at 4 C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEF
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RNF139.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11236
Iso type IgG

Enviar uma mensagem


RNF139 polyclonal antibody

RNF139 polyclonal antibody