AGT polyclonal antibody
  • AGT polyclonal antibody

AGT polyclonal antibody

Ref: AB-PAB28390
AGT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AGT.
Información adicional
Size 100 uL
Gene Name AGT
Gene Alias ANHU|FLJ92595|FLJ97926|SERPINA8
Gene Description angiotensinogen (serpin peptidase inhibitor, clade A, member 8)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQG
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AGT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 183
Iso type IgG

Enviar uma mensagem


AGT polyclonal antibody

AGT polyclonal antibody