C1R polyclonal antibody
  • C1R polyclonal antibody

C1R polyclonal antibody

Ref: AB-PAB28388
C1R polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1R.
Información adicional
Size 100 uL
Gene Name C1R
Gene Alias -
Gene Description complement component 1, r subcomponent
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq PNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLC
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1R.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 715
Iso type IgG

Enviar uma mensagem


C1R polyclonal antibody

C1R polyclonal antibody