STX8 polyclonal antibody
  • STX8 polyclonal antibody

STX8 polyclonal antibody

Ref: AB-PAB28386
STX8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STX8.
Información adicional
Size 100 uL
Gene Name STX8
Gene Alias CARB
Gene Description syntaxin 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq YDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLD
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STX8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9482
Iso type IgG

Enviar uma mensagem


STX8 polyclonal antibody

STX8 polyclonal antibody