ZNF350 polyclonal antibody
  • ZNF350 polyclonal antibody

ZNF350 polyclonal antibody

Ref: AB-PAB28381
ZNF350 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF350.
Información adicional
Size 100 uL
Gene Name ZNF350
Gene Alias ZBRK1|ZFQR
Gene Description zinc finger protein 350
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF350.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 59348
Iso type IgG

Enviar uma mensagem


ZNF350 polyclonal antibody

ZNF350 polyclonal antibody