PDE4D polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant PDE4D.

AB-PAB28329

New product

PDE4D polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name PDE4D
Gene Alias DPDE3|HSPDE4D|PDE4DN2|STRK1
Gene Description phosphodiesterase 4D, cAMP-specific (phosphodiesterase E3 dunce homolog, Drosophila)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>Immunofluorescence (1-4 ug/ml)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PDE4D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5144
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant PDE4D.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant PDE4D.

Rabbit polyclonal antibody raised against recombinant PDE4D.