NMUR2 polyclonal antibody
  • NMUR2 polyclonal antibody

NMUR2 polyclonal antibody

Ref: AB-PAB28326
NMUR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NMUR2.
Información adicional
Size 100 uL
Gene Name NMUR2
Gene Alias FM-4|FM4|NMU-R2|NMU2R|TGR-1|TGR1
Gene Description neuromedin U receptor 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RFQAAFQNVISSFHKQWHSQHDPQLPPAQRNIFLTECHFVELTEDIGPQFPCQSSMHNSHLPTALSSEQMSRTNYQSFHFN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant NMUR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56923
Iso type IgG

Enviar uma mensagem


NMUR2 polyclonal antibody

NMUR2 polyclonal antibody