HAPLN2 polyclonal antibody
  • HAPLN2 polyclonal antibody

HAPLN2 polyclonal antibody

Ref: AB-PAB28323
HAPLN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HAPLN2.
Información adicional
Size 100 uL
Gene Name HAPLN2
Gene Alias BRAL1
Gene Description hyaluronan and proteoglycan link protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant HAPLN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60484
Iso type IgG

Enviar uma mensagem


HAPLN2 polyclonal antibody

HAPLN2 polyclonal antibody