C1orf204 polyclonal antibody
  • C1orf204 polyclonal antibody

C1orf204 polyclonal antibody

Ref: AB-PAB28317
C1orf204 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf204.
Información adicional
Size 100 uL
Gene Name C1orf204
Gene Alias FLJ20442|FLJ39187
Gene Description chromosome 1 open reading frame 204
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C1orf204.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284677
Iso type IgG

Enviar uma mensagem


C1orf204 polyclonal antibody

C1orf204 polyclonal antibody