C6orf47 polyclonal antibody
  • C6orf47 polyclonal antibody

C6orf47 polyclonal antibody

Ref: AB-PAB28310
C6orf47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C6orf47.
Información adicional
Size 100 uL
Gene Name C6orf47
Gene Alias D6S53E|G4|NG34
Gene Description chromosome 6 open reading frame 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPGPGAPLEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C6orf47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57827
Iso type IgG

Enviar uma mensagem


C6orf47 polyclonal antibody

C6orf47 polyclonal antibody