ZMIZ1 polyclonal antibody
  • ZMIZ1 polyclonal antibody

ZMIZ1 polyclonal antibody

Ref: AB-PAB28307
ZMIZ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZMIZ1.
Información adicional
Size 100 uL
Gene Name ZMIZ1
Gene Alias FLJ13541|KIAA1224|MIZ|RAI17|Zimp10|hZIMP10
Gene Description zinc finger, MIZ-type containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ZMIZ1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57178
Iso type IgG

Enviar uma mensagem


ZMIZ1 polyclonal antibody

ZMIZ1 polyclonal antibody