BRP44L polyclonal antibody
  • BRP44L polyclonal antibody

BRP44L polyclonal antibody

Ref: AB-PAB28306
BRP44L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BRP44L.
Información adicional
Size 100 uL
Gene Name BRP44L
Gene Alias CGI-129|dJ68L15.3
Gene Description brain protein 44-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant BRP44L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51660
Iso type IgG

Enviar uma mensagem


BRP44L polyclonal antibody

BRP44L polyclonal antibody