PRNT polyclonal antibody
  • PRNT polyclonal antibody

PRNT polyclonal antibody

Ref: AB-PAB28297
PRNT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRNT.
Información adicional
Size 100 uL
Gene Name PRNT
Gene Alias -
Gene Description prion protein (testis specific)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LDASIHPFRLPFSSKPFLLIPMSNTTLPHTAWPLSFLHQTVSTLKAVAVTHSLWHLQIPVDCQACNR
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PRNT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149830
Iso type IgG

Enviar uma mensagem


PRNT polyclonal antibody

PRNT polyclonal antibody