NAP1L6 polyclonal antibody
  • NAP1L6 polyclonal antibody

NAP1L6 polyclonal antibody

Ref: AB-PAB28294
NAP1L6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NAP1L6.
Información adicional
Size 100 uL
Gene Name NAP1L6
Gene Alias FLJ33596
Gene Description nucleosome assembly protein 1-like 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant NAP1L6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 645996
Iso type IgG

Enviar uma mensagem


NAP1L6 polyclonal antibody

NAP1L6 polyclonal antibody