GAB4 polyclonal antibody
  • GAB4 polyclonal antibody

GAB4 polyclonal antibody

Ref: AB-PAB28290
GAB4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GAB4.
Información adicional
Size 100 uL
Gene Name GAB4
Gene Alias -
Gene Description GRB2-associated binding protein family, member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant GAB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 128954
Iso type IgG

Enviar uma mensagem


GAB4 polyclonal antibody

GAB4 polyclonal antibody