ARL15 polyclonal antibody
  • ARL15 polyclonal antibody

ARL15 polyclonal antibody

Ref: AB-PAB28289
ARL15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARL15.
Información adicional
Size 100 uL
Gene Name ARL15
Gene Alias ARFRP2|FLJ20051
Gene Description ADP-ribosylation factor-like 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSED
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ARL15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54622
Iso type IgG

Enviar uma mensagem


ARL15 polyclonal antibody

ARL15 polyclonal antibody