NME5 polyclonal antibody
  • NME5 polyclonal antibody

NME5 polyclonal antibody

Ref: AB-PAB28288
NME5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NME5.
Información adicional
Size 100 uL
Gene Name NME5
Gene Alias NM23-H5|NM23H5
Gene Description non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant NME5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8382
Iso type IgG

Enviar uma mensagem


NME5 polyclonal antibody

NME5 polyclonal antibody