PRKAB2 polyclonal antibody
  • PRKAB2 polyclonal antibody

PRKAB2 polyclonal antibody

Ref: AB-PAB28286
PRKAB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRKAB2.
Información adicional
Size 100 uL
Gene Name PRKAB2
Gene Alias MGC61468
Gene Description protein kinase, AMP-activated, beta 2 non-catalytic subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant PRKAB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5565
Iso type IgG

Enviar uma mensagem


PRKAB2 polyclonal antibody

PRKAB2 polyclonal antibody