POFUT2 polyclonal antibody
  • POFUT2 polyclonal antibody

POFUT2 polyclonal antibody

Ref: AB-PAB28284
POFUT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POFUT2.
Información adicional
Size 100 uL
Gene Name POFUT2
Gene Alias C21orf80|FUT13
Gene Description protein O-fucosyltransferase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant POFUT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23275
Iso type IgG

Enviar uma mensagem


POFUT2 polyclonal antibody

POFUT2 polyclonal antibody