DHDH polyclonal antibody
  • DHDH polyclonal antibody

DHDH polyclonal antibody

Ref: AB-PAB28280
DHDH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHDH.
Información adicional
Size 100 uL
Gene Name DHDH
Gene Alias HUM2DD
Gene Description dihydrodiol dehydrogenase (dimeric)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant DHDH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27294
Iso type IgG

Enviar uma mensagem


DHDH polyclonal antibody

DHDH polyclonal antibody