TUBGCP3 polyclonal antibody
  • TUBGCP3 polyclonal antibody

TUBGCP3 polyclonal antibody

Ref: AB-PAB28274
TUBGCP3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TUBGCP3.
Información adicional
Size 100 uL
Gene Name TUBGCP3
Gene Alias GCP3|SPBC98|Spc98p
Gene Description tubulin, gamma complex associated protein 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TUBGCP3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10426
Iso type IgG

Enviar uma mensagem


TUBGCP3 polyclonal antibody

TUBGCP3 polyclonal antibody