RPS25 polyclonal antibody
  • RPS25 polyclonal antibody

RPS25 polyclonal antibody

Ref: AB-PAB28270
RPS25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS25.
Información adicional
Size 100 uL
Gene Name RPS25
Gene Alias -
Gene Description ribosomal protein S25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RPS25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6230
Iso type IgG

Enviar uma mensagem


RPS25 polyclonal antibody

RPS25 polyclonal antibody