METTL11B polyclonal antibody
  • METTL11B polyclonal antibody

METTL11B polyclonal antibody

Ref: AB-PAB28268
METTL11B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL11B.
Información adicional
Size 100 uL
Gene Name METTL11B
Gene Alias C1orf184
Gene Description methyltransferase like 11B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFAL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant METTL11B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149281
Iso type IgG

Enviar uma mensagem


METTL11B polyclonal antibody

METTL11B polyclonal antibody