CNBD1 polyclonal antibody
  • CNBD1 polyclonal antibody

CNBD1 polyclonal antibody

Ref: AB-PAB28266
CNBD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNBD1.
Información adicional
Size 100 uL
Gene Name CNBD1
Gene Alias FLJ35802
Gene Description cyclic nucleotide binding domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AEMYLPSYDSMLSKWSTFGTLEVMPQNESETQMFSVVTEDDCEILKIPAKGYAKIKEEKIKLENMQKLKLIRMCPYYEEWPTLSIYELIALLKW
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CNBD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168975
Iso type IgG

Enviar uma mensagem


CNBD1 polyclonal antibody

CNBD1 polyclonal antibody