C2orf74 polyclonal antibody
  • C2orf74 polyclonal antibody

C2orf74 polyclonal antibody

Ref: AB-PAB28262
C2orf74 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2orf74.
Información adicional
Size 100 uL
Gene Name C2orf74
Gene Alias -
Gene Description chromosome 2 open reading frame 74
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DANGGVDCAAAKVVTSNPEDHERILMQVMNLNVPMRPGILVQRQSKEVLATPLENRRDMEAEEENQINEKQEPENAGETGQEEDDGLQKIHTSVTRTPSVVESQKRPLKGVTFSREVIVVDLGNEYPTPRSYT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C2orf74.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339804
Iso type IgG

Enviar uma mensagem


C2orf74 polyclonal antibody

C2orf74 polyclonal antibody