BAHCC1 polyclonal antibody
  • BAHCC1 polyclonal antibody

BAHCC1 polyclonal antibody

Ref: AB-PAB28256
BAHCC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BAHCC1.
Información adicional
Size 100 uL
Gene Name BAHCC1
Gene Alias BAHD2|FLJ23058|KIAA1447
Gene Description BAH domain and coiled-coil containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant BAHCC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57597
Iso type IgG

Enviar uma mensagem


BAHCC1 polyclonal antibody

BAHCC1 polyclonal antibody