CCDC57 polyclonal antibody
  • CCDC57 polyclonal antibody

CCDC57 polyclonal antibody

Ref: AB-PAB28252
CCDC57 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC57.
Información adicional
Size 100 uL
Gene Name CCDC57
Gene Alias FLJ00130|FLJ23754|FLJ43953|MGC102869
Gene Description coiled-coil domain containing 57
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTRKKEEETFKRKHEELDRLAREKDAVLVAVKGAHVEQLQELQTRVLELQAHCETLEAQLRRAEWRQADTAKEKDAAIDQLREDA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CCDC57.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284001
Iso type IgG

Enviar uma mensagem


CCDC57 polyclonal antibody

CCDC57 polyclonal antibody