HS3ST5 polyclonal antibody
  • HS3ST5 polyclonal antibody

HS3ST5 polyclonal antibody

Ref: AB-PAB28249
HS3ST5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HS3ST5.
Información adicional
Size 100 uL
Gene Name HS3ST5
Gene Alias 3-OST-5|3OST5|HS3OST5
Gene Description heparan sulfate (glucosamine) 3-O-sulfotransferase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHF
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant HS3ST5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222537
Iso type IgG

Enviar uma mensagem


HS3ST5 polyclonal antibody

HS3ST5 polyclonal antibody