CDRT4 polyclonal antibody
  • CDRT4 polyclonal antibody

CDRT4 polyclonal antibody

Ref: AB-PAB28247
CDRT4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CDRT4.
Información adicional
Size 100 uL
Gene Name CDRT4
Gene Alias FLJ36674|MGC33988|NBLA10383
Gene Description CMT1A duplicated region transcript 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CDRT4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284040
Iso type IgG

Enviar uma mensagem


CDRT4 polyclonal antibody

CDRT4 polyclonal antibody