CTA-221G9.4 polyclonal antibody
  • CTA-221G9.4 polyclonal antibody

CTA-221G9.4 polyclonal antibody

Ref: AB-PAB28240
CTA-221G9.4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CTA-221G9.4.
Información adicional
Size 100 uL
Gene Name CTA-221G9.4
Gene Alias KIAA1671
Gene Description KIAA1671 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PISHSLRRSRFSESESRSPLEDETDNTWMFKDSTEEKSPRKEESDEEETASKAERTPVSHPQRMPAFPGMDPAVLKAQLHKRPEVDSPGETPSWAPQPKSPKSPFQPGVLGSRVLPSSMDKDERSDEPSPQWLKELKSKKRQSL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CTA-221G9.4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 85379
Iso type IgG

Enviar uma mensagem


CTA-221G9.4 polyclonal antibody

CTA-221G9.4 polyclonal antibody