OR51J1 polyclonal antibody
  • OR51J1 polyclonal antibody

OR51J1 polyclonal antibody

Ref: AB-PAB28238
OR51J1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OR51J1.
Información adicional
Size 100 uL
Gene Name OR51J1
Gene Alias OR51J1P|OR51J2
Gene Description olfactory receptor, family 51, subfamily J, member 1 (gene/pseudogene)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNTEISLEACLFPDVLHPFFIHDGASCAAGHVFGPLYSHLQPTELHSYPDTAQGLWHRSYYRTEKHYAHGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant OR51J1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79470
Iso type IgG

Enviar uma mensagem


OR51J1 polyclonal antibody

OR51J1 polyclonal antibody