TTLL8 polyclonal antibody
  • TTLL8 polyclonal antibody

TTLL8 polyclonal antibody

Ref: AB-PAB28234
TTLL8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TTLL8.
Información adicional
Size 100 uL
Gene Name TTLL8
Gene Alias -
Gene Description tubulin tyrosine ligase-like family, member 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLEIGLCVNMRSLPWYVPANPDSFFPRCYSLCTESEQQEFLEDFRRTMASSILKWVVSHQSCSRSSRSKPRDQREEAGSSDLSSRQDAENAEAKLRGLPGQLVDIACKVCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWII
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant TTLL8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 164714
Iso type IgG

Enviar uma mensagem


TTLL8 polyclonal antibody

TTLL8 polyclonal antibody