NCBP2L polyclonal antibody
  • NCBP2L polyclonal antibody

NCBP2L polyclonal antibody

Ref: AB-PAB28226
NCBP2L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NCBP2L.
Información adicional
Size 100 uL
Gene Name NCBP2L
Gene Alias dJ820B18.1
Gene Description nuclear cap binding protein subunit 2-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFSRSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLTGTCLDEWIICTDWDVGFREGQQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant NCBP2L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 392517
Iso type IgG

Enviar uma mensagem


NCBP2L polyclonal antibody

NCBP2L polyclonal antibody