CARKD polyclonal antibody
  • CARKD polyclonal antibody

CARKD polyclonal antibody

Ref: AB-PAB28225
CARKD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CARKD.
Información adicional
Size 100 uL
Gene Name CARKD
Gene Alias FLJ10769|FLJ34548|LP3298
Gene Description carbohydrate kinase domain containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CARKD.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55739
Iso type IgG

Enviar uma mensagem


CARKD polyclonal antibody

CARKD polyclonal antibody