TMED7 polyclonal antibody
  • TMED7 polyclonal antibody

TMED7 polyclonal antibody

Ref: AB-PAB28224
TMED7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMED7.
Información adicional
Size 100 uL
Gene Name TMED7
Gene Alias CGI-109|FLJ90481
Gene Description transmembrane emp24 protein transport domain containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTF
Form Liquid
Recomended Dilution Western Blot (0.04-0.4 ug/mL)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMED7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51014
Iso type IgG

Enviar uma mensagem


TMED7 polyclonal antibody

TMED7 polyclonal antibody