RP11-544M22.4 polyclonal antibody
  • RP11-544M22.4 polyclonal antibody

RP11-544M22.4 polyclonal antibody

Ref: AB-PAB28221
RP11-544M22.4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RP11-544M22.4.
Información adicional
Size 100 uL
Gene Name RP11-544M22.4
Gene Alias LOC100131187
Gene Description KAT protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RP11-544M22.4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100131187
Iso type IgG

Enviar uma mensagem


RP11-544M22.4 polyclonal antibody

RP11-544M22.4 polyclonal antibody