ACVR2A polyclonal antibody
  • ACVR2A polyclonal antibody

ACVR2A polyclonal antibody

Ref: AB-PAB28207
ACVR2A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ACVR2A.
Información adicional
Size 100 uL
Gene Name ACVR2A
Gene Alias ACTRII|ACVR2
Gene Description activin A receptor, type IIA
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ACVR2A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92
Iso type IgG

Enviar uma mensagem


ACVR2A polyclonal antibody

ACVR2A polyclonal antibody