RSPO1 polyclonal antibody
  • RSPO1 polyclonal antibody

RSPO1 polyclonal antibody

Ref: AB-PAB28202
RSPO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RSPO1.
Información adicional
Size 100 uL
Gene Name RSPO1
Gene Alias CRISTIN3|FLJ40906|RSPO
Gene Description R-spondin homolog (Xenopus laevis)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant RSPO1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284654
Iso type IgG

Enviar uma mensagem


RSPO1 polyclonal antibody

RSPO1 polyclonal antibody