POM121L2 polyclonal antibody
  • POM121L2 polyclonal antibody

POM121L2 polyclonal antibody

Ref: AB-PAB28201
POM121L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POM121L2.
Información adicional
Size 100 uL
Gene Name POM121L2
Gene Alias POM121-L
Gene Description POM121 membrane glycoprotein-like 2 (rat)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHLSASAPPDATSAHLMLKPILGPLHNSEIGSSSYSRISVTAAASSISSLSTIQGTLTPTFKPIFGSIDPLKTTPMIAPFSSKQTPPPFTHAST
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant POM121L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 94026
Iso type IgG

Enviar uma mensagem


POM121L2 polyclonal antibody

POM121L2 polyclonal antibody