C19orf24 polyclonal antibody
  • C19orf24 polyclonal antibody

C19orf24 polyclonal antibody

Ref: AB-PAB28196
C19orf24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf24.
Información adicional
Size 100 uL
Gene Name C19orf24
Gene Alias FLJ20640
Gene Description chromosome 19 open reading frame 24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (0.25-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55009
Iso type IgG

Enviar uma mensagem


C19orf24 polyclonal antibody

C19orf24 polyclonal antibody