ARL16 polyclonal antibody
  • ARL16 polyclonal antibody

ARL16 polyclonal antibody

Ref: AB-PAB28154
ARL16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARL16.
Información adicional
Size 100 uL
Gene Name ARL16
Gene Alias -
Gene Description ADP-ribosylation factor-like 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TQLSASCVQLLGLLSAEQLAEASVLILFNKIDLPCYMSTEEMKSLIRLPDIIACAKQNITTAEISAREGTGLAGVLAWLQATHRAND
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant ARL16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 339231
Iso type IgG

Enviar uma mensagem


ARL16 polyclonal antibody

ARL16 polyclonal antibody