DPRX polyclonal antibody
  • DPRX polyclonal antibody

DPRX polyclonal antibody

Ref: AB-PAB28150
DPRX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPRX.
Información adicional
Size 100 uL
Gene Name DPRX
Gene Alias -
Gene Description divergent-paired related homeobox
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant DPRX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 503834
Iso type IgG

Enviar uma mensagem


DPRX polyclonal antibody

DPRX polyclonal antibody