CRB2 polyclonal antibody
  • CRB2 polyclonal antibody

CRB2 polyclonal antibody

Ref: AB-PAB28149
CRB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRB2.
Información adicional
Size 100 uL
Gene Name CRB2
Gene Alias FLJ16786|FLJ38464
Gene Description crumbs homolog 2 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RWDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFFPLPLDNSSQPSELGGRQSWNLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant CRB2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286204
Iso type IgG

Enviar uma mensagem


CRB2 polyclonal antibody

CRB2 polyclonal antibody