C4orf47 polyclonal antibody
  • C4orf47 polyclonal antibody

C4orf47 polyclonal antibody

Ref: AB-PAB28147
C4orf47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C4orf47.
Información adicional
Size 100 uL
Gene Name C4orf47
Gene Alias -
Gene Description chromosome 4 open reading frame 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of recombinant C4orf47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 441054
Iso type IgG

Enviar uma mensagem


C4orf47 polyclonal antibody

C4orf47 polyclonal antibody